.
The Open Protein Structure Annotation Network
PDB Keyword
.

2czl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8. J.Struct.Biol. 168 575-581 2009
    Site RSGI
    PDB Id 2czl Target Id ttk003001639.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14761, Molecular Weight 30032.80 Da.
    Residues 272 Isoelectric Point 5.57
    Sequence mealrlgfspcpndtfifyalvhgrvespvplepvledvetlnrwalegrlpltklsyaayaqvrdryv alrsggalgrgvgplvvargplqaleglrvavpgrhttayfllslyaqgfvpvevrydrilpmvaqgev eagliihesrftypryglvqvvdlgawweertglplplgailarrdlgegliraldeavrrsvayalah peealdymrahaqelsdeviwahvhtyvnafsldvgeegeravarlfaeaearglaapsprplfv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.209
    Matthews' coefficent 2.64 Rfactor 0.182
    Waters 316 Solvent Content 53.30

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 1;XPE (3,6,9,12,15,18,21,24,27-NONAOXANONACOSANE-1,29-DIOL) x 1
    Metals K (POTASSIUM) x 1

    Jmol

     
    Google Scholar output for 2czl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch