.
The Open Protein Structure Annotation Network
PDB Keyword
.

2czj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for functional mimicry of long-variable-arm tRNA by transfer-messenger RNA. Proc.Natl.Acad.Sci.Usa 104 8293-8298 2007
    Site RSGI
    PDB Id 2czj Target Id ttk003000801.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14444, Molecular Weight 16749.54 Da.
    Residues 144 Isoelectric Point 9.74
    Sequence mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapyekgsya nvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargkkayekrredkkeavr raleel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.01 Rfree 0.32
    Matthews' coefficent 3.70 Rfactor 0.255
    Waters Solvent Content 66.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2czj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch