.
The Open Protein Structure Annotation Network
PDB Keyword
.

2czg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Probable phosphoribosylglycinamide formyl transferase (PH0318) from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2czg Target Id pho001000318.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13811, Molecular Weight 48700.45 Da.
    Residues 433 Isoelectric Point 6.31
    Sequence mvvmiklrdelgtattdsaqkilllgsgelgkeiaieaqrlgvevvavdryanapamqvahrsyvgnmm dkdflwsvverekpdaiipeieainldalfefekdgyfvvpnaratwiamhrerlretlvkeakvptsr ymyattldelyeacekigypchtkaimsssgkgsyfvkgpedipkaweeaktkargsaekiiveehidf dvevtelavrhfdengeivttfpkpvghyqidgdyhaswqpaeisekaerevyriakritdvlgglgif gvemfvkgdkvwanevsprphdtgmvtlashppgfsefalhlravlglpipgewvdgyrlfpmlipaat hvikakvsgysprfrglvkalsvpnatvrlfgkpeayvgrrlgialawdkdvevakrkaemvahmielr trssdwhdqnyekrkhllr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.228
    Matthews' coefficent 3.58 Rfactor 0.194
    Waters 188 Solvent Content 65.68

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 11
    Metals

    Jmol

     
    Google Scholar output for 2czg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch