The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 at 1.6 A resolution. To be Published
    Site RSGI
    PDB Id 2czd Target Id pho001000731.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13939, Molecular Weight 26203.83 Da.
    Residues 241 Isoelectric Point 7.77
    Sequence mgrnpsespqecnsrglypkergdnarntgggqvivlaldvyegeraikiaksvkdyismikvnwplil gsgvdiirrlkeetgveiiadlkladipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimv vemshpgalefinpltdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakda vkagadyiivgraiynapnpreaakaiydeirgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.197
    Matthews' coefficent 2.12 Rfactor 0.172
    Waters 368 Solvent Content 41.89

    Ligand Information


    Google Scholar output for 2czd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch