.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cz8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of tt0972 protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2cz8 Target Id ttk003000972.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14499, Molecular Weight 7747.56 Da.
    Residues 69 Isoelectric Point 5.82
    Sequence mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvlevgfrleet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.50 Rfree 0.229
    Matthews' coefficent 2.60 Rfactor 0.205
    Waters 652 Solvent Content 51.80

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 9;FAD (FLAVIN-ADENINE) x 8
    Metals K (POTASSIUM) x 4

    Jmol

     
    Google Scholar output for 2cz8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch