The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from Mus musculus (form-2 crystal). To be Published
    Site RSGI
    PDB Id 2cz3 Target Id mmk001000137.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13418, Molecular Weight 24273.94 Da.
    Residues 216 Isoelectric Point 7.68
    Sequence mqagkpilysyfrsscswrvrialalkgidyeivpinlikdggqqfteefqtlnpmkqvpalkidgiti vqslaimeyleetrpiprllpqdpqkraivrmisdliasgiqplqnlsvlkqvgqenqmqwaqkvitsg fnalekilqstagkycvgdevsmadvclvpqvanaerfkvdlspyptishinkellalevfqvshprrq pdtpaelrt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.27474
    Matthews' coefficent 1.99 Rfactor 0.21794
    Waters 73 Solvent Content 36.90

    Ligand Information


    Google Scholar output for 2cz3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch