The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein PH1505 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2cyj Target Id pho001001505.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13994, Molecular Weight 13672.42 Da.
    Residues 118 Isoelectric Point 6.44
    Sequence mkieevrfglvkidgkefdhdiviypsgrierrmkeiskkkhgtshkldpeelekylvedfdvllvgtg iygmlsllpeskklvedkeviekptkealklleelwgkkrilaiihvtc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.201
    Matthews' coefficent 1.92 Rfactor 0.179
    Waters 122 Solvent Content 36.08

    Ligand Information
    Ligands ACT (ACETATE) x 1;SO4 (SULFATE) x 1


    Google Scholar output for 2cyj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch