.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cy5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-2 crystal). To be Published
    Site RSGI
    PDB Id 2cy5 Target Id mmt007011014.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13523, Molecular Weight 15675.01 Da.
    Residues 140 Isoelectric Point 5.03
    Sequence stvvmadvsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlldpvske elesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelirediqgalqnyrsgrg er
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.234
    Matthews' coefficent 2.97 Rfactor 0.206
    Waters 94 Solvent Content 57.80

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 2cy5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch