.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable GTP-binding protein engB. To be Published
    Site RSGI
    PDB Id 2cxx Target Id pho001000200.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13794, Molecular Weight 22023.80 Da.
    Residues 190 Isoelectric Point 9.66
    Sequence matiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmglpkevqerik deivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflreldiptivavnkldkiknv qevinflaekfevplseidkvfipisakfgdnierlknrifevirerqgrrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.202
    Matthews' coefficent 2.10 Rfactor 0.164
    Waters 563 Solvent Content 36.67

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2cxx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch