.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of probable ribosomal biogenesis protein from Aeropyrum pernix K1. To be Published
    Site RSGI
    PDB Id 2cxh Target Id ape001001443.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12104, Molecular Weight 21418.72 Da.
    Residues 197 Isoelectric Point 11.07
    Sequence mlggkgrpsgvggyrilvttsrrpsprirsfvkdlsatipgafrftrghysmeelareaiirgadrivv vgerrgnpgiirvyavegperpdnivsfivkgvslsrerrwglpslrggevlvarpldsgvavefadaf viafharlkppeaagyveaviesldartvavtfryggapvgpmlrlgkpaemvkrgrrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.209
    Matthews' coefficent 2.27 Rfactor 0.184
    Waters 150 Solvent Content 45.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cxh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch