.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cxd Target Id ttk003001478.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14732, Molecular Weight 10940.22 Da.
    Residues 94 Isoelectric Point 9.84
    Sequence mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglrnlrkaearl eglpcplmgldwrsllqearrrlga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.229
    Matthews' coefficent 1.90 Rfactor 0.192
    Waters 186 Solvent Content 36.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cxd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch