.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure and RNA-binding analysis of the archaeal transcription factor NusA. Biochem.Biophys.Res.Commun. 355 122-128 2007
    Site RSGI
    PDB Id 2cxc Target Id ape001001850.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12110, Molecular Weight 16041.84 Da.
    Residues 144 Isoelectric Point 9.67
    Sequence msgdyritleelryisvfhsitgvtayrcivdeennrliflvsegeagraigrggrlikllrealgkni evveyssdlerivknlfpgvkiesinvrerngvkqvvikvseddkgaaigkggknvkrarlvlsklfgv ekvvir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2112
    Matthews' coefficent 3.60 Rfactor 0.1844
    Waters 54 Solvent Content 65.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cxc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch