.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cxa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of leucyl/phenylalanyl-tRNA-protein transferase from Escherichia coli. Protein Sci. 16 528-534 2007
    Site RSGI
    PDB Id 2cxa Target Id eco002000868.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12278, Molecular Weight 26617.11 Da.
    Residues 234 Isoelectric Point 6.75
    Sequence mrlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwwspdpravlwp eslhisrsmkrfhkrspyrvtmnyafgqviegcasdreegtwitrgvveayhrlhelghahsievwred elvggmygvaqgtlfcgesmfsrmenasktallvfceefighggklidcqvlndhtaslgaceiprrdy lnylnqmrlgrlpnnfwvprclfspqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.217
    Matthews' coefficent 1.87 Rfactor 0.187
    Waters 267 Solvent Content 34.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cxa

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch