.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cx8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methyltransferase with ligand(SAH). To be Published
    Site RSGI
    PDB Id 2cx8 Target Id ttk003001573.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14745, Molecular Weight 24669.46 Da.
    Residues 228 Isoelectric Point 9.50
    Sequence mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvleerrperev gvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlravaleaakqsgrvvvp evlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggfaeeevalleargftpvslgrr ilraetaalallalctagegr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.53 Rfree 0.285
    Matthews' coefficent 2.11 Rfactor 0.223
    Waters 97 Solvent Content 41.59

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2cx8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch