The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of sterol carrier protein 2. To be Published
    Site RSGI
    PDB Id 2cx7 Target Id ttk003001886.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14817, Molecular Weight 14069.37 Da.
    Residues 130 Isoelectric Point 5.10
    Sequence melfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvldlwhgacrgakavege aeadfvieadlatwqevlegrleplsalmrgllelkkgtiaalapyaqaaqelvkvareva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.27
    Matthews' coefficent 2.03 Rfactor 0.213
    Waters 310 Solvent Content 39.34

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1


    Google Scholar output for 2cx7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch