The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ribonuclease inhibitor Barstar. To be Published
    Site RSGI
    PDB Id 2cx6 Target Id eco002003208.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12286, Molecular Weight 10795.58 Da.
    Residues 90 Isoelectric Point 4.48
    Sequence mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlgektrrrfgal illfdeaeeeleghlrfnvrh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.43 Rfree 0.295
    Matthews' coefficent 2.69 Rfactor 0.229
    Waters 34 Solvent Content 54.29

    Ligand Information


    Google Scholar output for 2cx6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch