.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cx4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-2 crystal). To be Published
    Site RSGI
    PDB Id 2cx4 Target Id ape001002125.2
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12115, Molecular Weight 18669.64 Da.
    Residues 164 Isoelectric Point 5.57
    Sequence mkglvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqlekanae vlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakravfivkpdgtvaykwv tdnplnepdydevvreankiagelva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.30 Rfree 0.263
    Matthews' coefficent 3.13 Rfactor 0.203
    Waters 407 Solvent Content 60.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cx4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch