The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex). To be Published
    Site RSGI
    PDB Id 2cx1 Target Id ape001000525.2
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12099, Molecular Weight 20732.08 Da.
    Residues 186 Isoelectric Point 9.62
    Sequence mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiitvdgvpclfe wsdgriyptlqclkafgvdwlkgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtp vmvgvaevdssaleklyrekargravrrvhrlgdalwelaqevgkrls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.192
    Matthews' coefficent 2.42 Rfactor 0.163
    Waters 178 Solvent Content 48.29

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 1


    Google Scholar output for 2cx1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch