.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cx0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (sulfate complex). To be Published
    Site RSGI
    PDB Id 2cx0 Target Id ape001000525.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12098, Molecular Weight 20732.08 Da.
    Residues 186 Isoelectric Point 9.62
    Sequence mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiitvdgvpclfe wsdgriyptlqclkafgvdwlkgvvlvdkgaaialakgahlmipgvvgvegsftrgdvvaalyhetrtp vmvgvaevdssaleklyrekargravrrvhrlgdalwelaqevgkrls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.199
    Matthews' coefficent 2.40 Rfactor 0.173
    Waters 158 Solvent Content 47.79

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2cx0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch