.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cwq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the conserved protein TTHA0727 from Thermus thermophilus HB8 at 1.9 A resolution: A CMD family member distinct from carboxymuconolactone decarboxylase (CMD) and AhpD. Protein Sci. 15 1187-1192 2006
    Site RSGI
    PDB Id 2cwq Target Id ttk003001628.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14759, Molecular Weight 12580.07 Da.
    Residues 117 Isoelectric Point 8.89
    Sequence mdrthervlqamaenlgeglpraipllaekapglllehgrswtyampekgaldektrtlillgialatg seacvkamahrakrlglskealletlkiarqaqanavlghaapllevl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.213
    Matthews' coefficent 2.08 Rfactor 0.165
    Waters 262 Solvent Content 40.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cwq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch