The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of The Single-stranded DNA Binding Protein From Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cwa Target Id ttk003000768.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14426, Molecular Weight 29880.88 Da.
    Residues 263 Isoelectric Point 5.20
    Sequence marglnrvfligalatrpdmrytpaglaildltlagqdlllsdnggerevswyhrvrllgrqaemwgdl ldqgqlvfvegrleyrqweregerrselqiradfldplddrgkeraedsrgqprlraalnqvflmgnlt rdpelrytpqgtavarlglavnerrqgaeerthfvevqawrdlaewaaelrkgdglfvigrlvndswts ssgerrfqtrvealrlerptrgpaqaggsrsrevqtggvdidegledfppeeelpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.96 Rfree 0.282
    Matthews' coefficent 2.70 Rfactor 0.242
    Waters 144 Solvent Content 53.80

    Ligand Information
    Ligands NO3 (NITRATE) x 3


    Google Scholar output for 2cwa

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch