.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cw4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA0137 from Thermus Thermophilus HB8. TO BE PUBLISHED
    Site RSGI
    PDB Id 2cw4 Target Id ttk003000865.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14460, Molecular Weight 13144.41 Da.
    Residues 124 Isoelectric Point 5.18
    Sequence meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavleaagsglsr vvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacvalae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.182
    Matthews' coefficent 2.20 Rfactor 0.145
    Waters 59 Solvent Content 43.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cw4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch