.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cvz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Novel NADP-dependent 3-Hydroxyisobutyrate Dehydrogenase from Thermus thermophilus HB8. J.Mol.Biol. 352 905-917 2005
    Site RSGI
    PDB Id 2cvz Target Id ttk003000368.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14354, Molecular Weight 31338.42 Da.
    Residues 289 Isoelectric Point 6.57
    Sequence mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearviftclpttrev yevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggtsgaeagtltvmlggpeea vervrpflayakkvvhvgpvgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrs natenlipqrvltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhvea lrllerwggveir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.2
    Matthews' coefficent 2.80 Rfactor 0.1816
    Waters 856 Solvent Content 55.78

    Ligand Information
    Ligands NDP (NADPH) x 3
    Metals

    Jmol

     
    Google Scholar output for 2cvz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch