The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of thioredoxin reductase-related protein TTHA0370 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cvj Target Id ttk003001393.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14716, Molecular Weight 19122.84 Da.
    Residues 180 Isoelectric Point 7.88
    Sequence mwdvivvgggpsglsaalflaraglkvlvldggrskvkgvsrvpnypglldepsgeellrrleaharry gaevrpgvvkgvrdmggvfeveteegvekaerlllcthkdptlpsllgltrrgayidtdeggrtsyprv yaagvargkvpghaiisagdgayvavhlvsdlrgepykdhal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.236
    Matthews' coefficent 2.80 Rfactor 0.203
    Waters 133 Solvent Content 55.40

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1


    Google Scholar output for 2cvj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch