.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cve

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein TT1547 from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cve Target Id ttk003001547.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14739, Molecular Weight 20654.61 Da.
    Residues 191 Isoelectric Point 6.02
    Sequence msltladkvvyeeeiqksrfiakaapvaseeealaflaenrepeathnghaykigllyrfsddgepsgt agrpilhaieaqgldrvavlvvryfggvklgagglvrayggvaaealrrapkvplvervglaflvpfae vgrvyallearalkaeetytpegvrfalllpkperegflralldatrgqvale
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.238
    Matthews' coefficent 2.50 Rfactor 0.212
    Waters 168 Solvent Content 50.90

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2cve

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch