.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cv4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Archaeal Peroxiredoxin from the Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1. J.Mol.Biol. 354 317-329 2005
    Site RSGI
    PDB Id 2cv4 Target Id ape001002278.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12116, Molecular Weight 28701.49 Da.
    Residues 250 Isoelectric Point 6.32
    Sequence mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedfqrlgv dliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesathtvrgvfivdargvir tmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigeglivpppttedqararmesgqyrc ldwwfcwdtpasrddveearrylrraaekpakllyeearthlh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.30 Rfree 0.23
    Matthews' coefficent 2.62 Rfactor 0.178
    Waters 814 Solvent Content 52.20

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2;IPA (ISOPROPYL) x 9
    Metals

    Jmol

     
    Google Scholar output for 2cv4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch