.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cv1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu), ATP, and an analog of L-glutamate: a quaternary complex. To be Published
    Site RSGI
    PDB Id 2cv1 Target Id ttk003000897.6
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14488, Molecular Weight 53906.93 Da.
    Residues 468 Isoelectric Point 6.53
    Sequence mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaalkwlglsyde gpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekggydgrarnippeeaeera rrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllksdgyptyhlanvvddhlmgvtdvirae ewlvstpihvllyrafgweaprfyhmpllrnpdktkiskrkshtsldwykaegflpealrnylclmgfs mpdgreiftleefiqaftwervslggpvfdleklrwmngkyirevlsleevaervkpflreaglswese aylrravelmrprfdtlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaalea llrgfaaekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.41 Rfree 0.277
    Matthews' coefficent 2.50 Rfactor 0.221
    Waters 182 Solvent Content 51.00

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2;GAU ((4S)-4-AMINO-5-HYDROXYPENTANOIC) x 2
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 2cv1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch