.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cv0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural bases of transfer RNA-dependent amino acid recognition and activation by glutamyl-tRNA synthetase. Structure 14 1791-1799 2006
    Site RSGI
    PDB Id 2cv0 Target Id ttk003000897.8
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14490, Molecular Weight 53906.93 Da.
    Residues 468 Isoelectric Point 6.53
    Sequence mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaalkwlglsyde gpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekggydgrarnippeeaeera rrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllksdgyptyhlanvvddhlmgvtdvirae ewlvstpihvllyrafgweaprfyhmpllrnpdktkiskrkshtsldwykaegflpealrnylclmgfs mpdgreiftleefiqaftwervslggpvfdleklrwmngkyirevlsleevaervkpflreaglswese aylrravelmrprfdtlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaalea llrgfaaekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.271
    Matthews' coefficent 2.61 Rfactor 0.212
    Waters 281 Solvent Content 52.94

    Ligand Information
    Ligands GLU x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2cv0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch