.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cuy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of malonyl CoA-acyl carrier protein transacylase from Thermus thermophilus HB8. TO BE PUBLISHED
    Site RSGI
    PDB Id 2cuy Target Id ttk003000135.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14242, Molecular Weight 33466.71 Da.
    Residues 305 Isoelectric Point 5.81
    Sequence myaalfpgqgshrvgmgralyeaspaakevldraeaalpgllklmwegpeealtltenqqpallaagya ayrafleaggkppalpeghslgewtahvaagtleledalrlvrlrgrymqeavpvgegamaavlklple eiqkaleglegveianlnapeqtvisgrrqaveeaaerlkerrarvvflpvsapfhsslmaparkrlae dlaqvplrrprfpvysnvtarpeedperirallleqitapvrwveilrdmeargvkrflefgsgevlkg lvlrtlkeaealsvqdpdslrkalevera
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2579
    Matthews' coefficent 3.68 Rfactor 0.2257
    Waters 672 Solvent Content 66.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cuy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch