.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cun

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Phosphoglycerate Kinase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2cun Target Id pho001001218.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13978, Molecular Weight 46400.31 Da.
    Residues 410 Isoelectric Point 6.79
    Sequence mfrledfnfhnktvflrvdlnspmkdgkiisdarfkavlptiryliesgakvvigthqgkpysedyttt eeharvlselldqhveyiedifgryarekikelksgevailenlrfsaeevknkpieecektflvkkls kvidyvvndafatahrsqpslvgfarikpmimgflmekeiealmrayyskdspkiyvlggakvedslkv venvlrreradlvltgglvanvftlakgfdlgrknvefmkkkglldyvkhaeeildefypyirtpvdfa vdykgerveidllsenrgllhqyqimdigkrtaekyreilmkariivangpmgvfereefaigtvevfk aiadspafsvlggghsiasiqkygitgithistgggamlsffageelpvlralqisyekfkevvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.244
    Matthews' coefficent 2.74 Rfactor 0.21
    Waters 371 Solvent Content 55.11

    Ligand Information
    Ligands 3PG (3-PHOSPHOGLYCERIC) x 2;GOL (GLYCEROL) x 2;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 3
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2cun

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch