The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the 33rd fibronectin type III domain of human Tenascin-X. To be Published
    Site RSGI
    PDB Id 2cum Target Id hso002001012.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12942, Molecular Weight 9954.86 Da.
    Residues 92 Isoelectric Point 6.94
    Sequence leaprdleakevtprtalltwteppvrpagyllsfhtpggqtqeillpggitshqllglfpstsynarl qamwgqsllppvstsfttgglri
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cum

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch