.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cul

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the small form of glucose-inhibited division protein A from Thermus thermophilus HB8. Proteins 61 1121-1126 2005
    Site RSGI
    PDB Id 2cul Target Id ttk003001157.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14529, Molecular Weight 25821.36 Da.
    Residues 232 Isoelectric Point 6.02
    Sequence maayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgslleraydpkdervwa fharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvlavgsflgarlflggvveea grlseasypdlledlsrlgfrfveregevpetpstpgyrvrylafhpeeweektfrlkrleglyavglc vregdyarmseegkrlaehllhelg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.199
    Matthews' coefficent 2.30 Rfactor 0.18
    Waters 195 Solvent Content 45.60

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2cul

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch