The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and Functional Differences of SWIRM Domain Subtypes. J.Mol.Biol. 369 222-238 2007
    Site RSGI
    PDB Id 2cuj Target Id mmt008012850.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13663, Molecular Weight 11139.35 Da.
    Residues 101 Isoelectric Point 9.55
    Sequence idsglspsvlmasnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqggl rlaqaralikidvnktrkiydfliregyitka
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cuj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch