The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the homeobox domain of the human hypothetical protein FLJ21616. To be Published
    Site RSGI
    PDB Id 2cuf Target Id hsi002013329.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12496, Molecular Weight 9650.52 Da.
    Residues 82 Isoelectric Point 9.64
    Sequence rgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkvynwfanrrke ikrraniaailes
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2cuf

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch