.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cuc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain of the mouse hypothetical protein SH3RF2. To be Published
    Site RSGI
    PDB Id 2cuc Target Id mmt008000206.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13615, Molecular Weight 6388.03 Da.
    Residues 57 Isoelectric Point 6.93
    Sequence nmfvalhtysahrpeeldlqkgegirvlgkyqdgwlkglslltgrtgifpsdyvipv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cuc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch