.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cu9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Fission Yeast Histone Chaperone Asf1 Complexed with the Hip1 B-domain or the Cac2 C Terminus. J.Biol.Chem. 283 14022-14031 2008
    Site RSGI
    PDB Id 2cu9 Target Id ar_001000283.1
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS12137, Molecular Weight 18333.05 Da.
    Residues 161 Isoelectric Point 4.41
    Sequence msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtllvgpipigi nkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeglnlqemddaeikkvkvdi skvwrsilaekprvtrfniqwdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.23891
    Matthews' coefficent 2.68 Rfactor 0.19136
    Waters 248 Solvent Content 58.00

    Ligand Information
    Ligands PG0 (2-(2-METHOXYETHOXY)ETHANOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2cu9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch