.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cu6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cu6 Target Id ttk003001362.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14704, Molecular Weight 11437.56 Da.
    Residues 103 Isoelectric Point 4.66
    Sequence mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavrqals rlpgveevevevtfeppwtlarlsekarrllgwg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 3.56 Rfactor 0.215
    Waters 96 Solvent Content 65.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cu6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch