.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cu3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT1568 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2cu3 Target Id ttk003001568.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14743, Molecular Weight 6985.79 Da.
    Residues 64 Isoelectric Point 4.31
    Sequence mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevvalmqgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.241
    Matthews' coefficent 2.10 Rfactor 0.224
    Waters 152 Solvent Content 40.50

    Ligand Information
    Ligands
    Metals CD (CADMIUM) x 1

    Jmol

     
    Google Scholar output for 2cu3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch