The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of J-domain from human DnaJ subfamily B menber 12. To be Published
    Site RSGI
    PDB Id 2ctp Target Id hss001000182.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13187, Molecular Weight 7317.80 Da.
    Residues 65 Isoelectric Point 8.97
    Sequence dyyeilgvsrgasdedlkkayrrlalkfhpdknhapgateafkaigtayavlsnpekrkqydqfg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ctp

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch