.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ct8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for anticodon recognition by methionyl-tRNA synthetase. Nat.Struct.Mol.Biol. 12 931-932 2005
    Site RSGI
    PDB Id 2ct8 Target Id aae001001257.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12062, Molecular Weight 58927.96 Da.
    Residues 497 Isoelectric Point 7.18
    Sequence mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqkkaeelgisp kelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiylgeyegwycvgceefkse aelaedhtcpihqkkceyikepsyffrlskyqdkllelyeknpefiqpdyrrneiisfvkqglkdlsvt rprsrvkwgipvpfdpehtiyvwfdalfnyisaledkveiywpadlhlvgkdilrfhtvywpaflmslg yelpkkvfahgwwtvegkkmsktlgnvvdpyevvqeygldevryfllrevpfgqdgdfskkailnring elaneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeilkftsylnk yvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqmlgekeflkelkpysknty klgerkilfpkreg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.272
    Matthews' coefficent 2.46 Rfactor 0.217
    Waters 78 Solvent Content 49.94

    Ligand Information
    Ligands MSP (5'-O-[(L-METHIONYL)-SULPHAMOYL]ADENOSINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ct8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch