The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the IBR domain of the RING finger protein 31 protein. To be Published
    Site RSGI
    PDB Id 2ct7 Target Id hsi002012616.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12478, Molecular Weight 8944.88 Da.
    Residues 73 Isoelectric Point 8.57
    Sequence alfhkkltegvlmrdpkflwcaqcsfgfiyereqleatcpqchqtfcvrckrqweeqhrgrscedfqnw krmn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2ct7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch