The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Strutcure of the SH3 domain of the Cdc42-interacting protein 4. To be Published
    Site RSGI
    PDB Id 2ct4 Target Id hss001002741.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13304, Molecular Weight 6294.60 Da.
    Residues 57 Isoelectric Point 4.77
    Sequence ghcvaiyhfegssegtismaegedlslmeedkgdgwtrvrrkeggegyvptsylrvt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ct4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch