The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RING domain of the Tripartite motif protein 32. To be Published
    Site RSGI
    PDB Id 2ct2 Target Id hsi002005098.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12381, Molecular Weight 8489.54 Da.
    Residues 75 Isoelectric Point 7.75
    Sequence nldalrevlecpicmesfteeqlrpkllhcghticrqclekllassingvrcpfcskitritsltqltd nltvlk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2ct2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch