.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ct1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein. To be Published
    Site RSGI
    PDB Id 2ct1 Target Id hss001000882.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13221, Molecular Weight 7492.26 Da.
    Residues 64 Isoelectric Point 9.27
    Sequence rthsgekpyecyicharftqsgtmkmhilqkhtenvakfhcphcdtviarksdlgvhlrkqhsy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2ct1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch