.
The Open Protein Structure Annotation Network
PDB Keyword
.

2csy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RING domain of the Zinc finger protein 183-like 1. To be Published
    Site RSGI
    PDB Id 2csy Target Id hsi002010760.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12434, Molecular Weight 7887.71 Da.
    Residues 68 Isoelectric Point 7.74
    Sequence gseeeeipfrcficrqafqnpvvtkcrhyfcescalehfratprcyicdqptggifnpakelmaklqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2csy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch