.
The Open Protein Structure Annotation Network
PDB Keyword
.

2csv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the zf-B_box type2 domain of human tripartite motif protein TRIM29 isoform alpha. To be published
    Site RSGI
    PDB Id 2csv Target Id hss001001220.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13247, Molecular Weight 6918.57 Da.
    Residues 59 Isoelectric Point 5.28
    Sequence qllepirdfearkcpvhgktmelfcqtdqtcicylcmfqehknhstvtveeakaekete
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2csv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch