.
The Open Protein Structure Annotation Network
PDB Keyword
.

2csf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second CUT domain of human SATB2. To be Published
    Site RSGI
    PDB Id 2csf Target Id hsk002001010.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12629, Molecular Weight 10270.16 Da.
    Residues 88 Isoelectric Point 5.85
    Sequence pikvdganinitaaiydeiqqemkrakvsqalfakvaanksqgwlcellrwkenpspenrtlwenlcti rrflnlpqherdviyeees
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2csf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch