.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cry

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the fifth ig-like domain of human kin of IRRE like 3. To be published
    Site RSGI
    PDB Id 2cry Target Id hsk002001834
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12687, Molecular Weight 12073.86 Da.
    Residues 109 Isoelectric Point 5.27
    Sequence tltvngppiisstqtqhalhgekgqikcfirstpppdriawswkenvlesgtsgrytvetisteegvis tltisnivradfqtiynctawnsfgsdteiirlkeqgsem
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2cry

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch