The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ArfGap domain of ADP-ribosylation factor GTPaseactivating protein 3 (ArfGap 3). To be published
    Site RSGI
    PDB Id 2crw Target Id hss001001677.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13277, Molecular Weight 15197.30 Da.
    Residues 136 Isoelectric Point 9.17
    Sequence mgdpskqdiltifkrlrsvptnkvcfdcgaknpswasitygvflcidcsgshrslgvhlsfirstelds nwswfqlrcmqvggnasassffhqhgcstndtnakynsraaqlyrekikslasqatrkhgtdlwlds
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2crw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch