.
The Open Protein Structure Annotation Network
PDB Keyword
.

2crv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of C-terminal domain of mitochondrial translational initiationfactor 2. To be published
    Site RSGI
    PDB Id 2crv Target Id mmi002017117.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13400, Molecular Weight 12060.33 Da.
    Residues 107 Isoelectric Point 8.77
    Sequence ypigeasilatftvtegkkkipvadcrvqkgqlerhkkfklirngqviwkgsltslkhhkddisviktg mdcglsldeekvefkpgdqvicyeenkvptktswdpgf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2crv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch